SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1L8P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1L8P5
Domain Number 1 Region: 44-310
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.97e-98
Family Capz beta-1 subunit 0.000000000431
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1L8P5
Sequence length 314
Comment (tr|G1L8P5|G1L8P5_AILME) Capping actin protein of muscle Z-line beta subunit {ECO:0000313|Ensembl:ENSAMEP00000003264} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=CAPZB OC=Ailuropoda.
Sequence
GRWAARPTYGLDTMHPSRRSLPFPLNCQLVRVGTADYGGASDQSDQQLDCALDLMRRLPP
QQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNK
YDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAG
DGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQME
KDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEAL
KNDLVEALKRKQQC
Download sequence
Identical sequences G1L8P5
ENSAMEP00000003264 ENSAMEP00000003264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]