SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1LD03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1LD03
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.38e-41
Family Calponin-homology domain, CH-domain 0.000000566
Further Details:      
 
Domain Number 2 Region: 173-229
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000353
Family EB1 dimerisation domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1LD03
Sequence length 253
Comment (tr|G1LD03|G1LD03_AILME) Uncharacterized protein {ECO:0000313|Ensembl:ENSAMEP00000004784} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN= OC=Ailuropoda.
Sequence
STSVTSDNLSPHDTLAWINESLLWNLTKIEQLCSGAAYCQFTDMLFPGSNALKKVKFQAK
LEHEYIQNFKILQADFKRMDVDKIIPVDKLVKGMFQDNFEFVQWFKKFFDANHDGKDYDP
VAAKNSNGSLLHCSSSEQTEQTPWAPQRPIATPRTTATPEAGRAGGGGDEEAAELMEQAN
VLKLTAEDLGKERDFHFGKLRNIALICQENERELQKMVDILYATGEGFVIPDEGGPQEEQ
EEYEQPGPAEQHL
Download sequence
Identical sequences G1LD03
ENSAMEP00000004784 ENSAMEP00000004784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]