SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1N026 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N026
Domain Number 1 Region: 10-282
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-114
Family Capz alpha-1 subunit 0.000000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1N026
Sequence length 287
Comment (tr|G1N026|G1N026_MELGA) Capping actin protein of muscle Z-line alpha subunit 1 {ECO:0000313|Ensembl:ENSMGAP00000004711} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=CAPZA1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
CAAVSNKRLLQDKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQW
RDACDSALRAYVKDHYPNGFCTVVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKF
TITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEY
QTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences G1N026
ENSMGAP00000004711 ENSMGAP00000004711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]