SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1PEI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PEI5
Domain Number 1 Region: 8-282
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.58e-115
Family Capz alpha-1 subunit 0.000000000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PEI5
Sequence length 287
Comment (tr|G1PEI5|G1PEI5_MYOLU) Capping actin protein of muscle Z-line alpha subunit 1 {ECO:0000313|Ensembl:ENSMLUP00000008929} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=CAPZA1 OC=Vespertilionidae; Myotis.
Sequence
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLSNDNLLREGAAHAFAQYNMD
QFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGGLKSW
RESCDSALRAYVKDHYSSGFCTVVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKF
TITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEAQTAKEFIKIIEHAENEY
QTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences G1PEI5
ENSMLUP00000008929 ENSMLUP00000008929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]