SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PTK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PTK6
Domain Number 1 Region: 33-107
Classification Level Classification E-value
Superfamily Mitochondrial ATP synthase coupling factor 6 1.57e-31
Family Mitochondrial ATP synthase coupling factor 6 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PTK6
Sequence length 108
Comment (tr|G1PTK6|G1PTK6_MYOLU) ATP synthase-coupling factor 6, mitochondrial {ECO:0000256|PIRNR:PIRNR002455} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=ATP5J OC=Vespertilionidae; Myotis.
Sequence
MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPLQKLFVDKIREYKTKRQSSGGP
VDAGPEYQQDMEKELFKLKQMYGKADMNTFPDFKFEDPKFEVVEKPQS
Download sequence
Identical sequences G1PTK6
ENSMLUP00000014562 XP_005861268.1.60319 XP_005861269.1.60319 XP_006096013.1.53796 XP_006096014.1.53796 XP_006758818.1.95426 XP_006758819.1.95426 ENSMLUP00000014562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]