SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RPQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RPQ5
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily Synuclein 6.02e-50
Family Synuclein 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1RPQ5
Sequence length 135
Comment (tr|G1RPQ5|G1RPQ5_NOMLE) Beta-synuclein {ECO:0000256|RuleBase:RU361225} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=SNCB OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTK
EQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYE
DPPQEEYQEXXXXXX
Download sequence
Identical sequences G1RPQ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]