SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SKE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SKE0
Domain Number 1 Region: 43-171
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-45
Family Calponin-homology domain, CH-domain 0.000000646
Further Details:      
 
Domain Number 2 Region: 241-301
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 6.28e-19
Family EB1 dimerisation domain-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1SKE0
Sequence length 325
Comment (tr|G1SKE0|G1SKE0_RABIT) Microtubule associated protein RP/EB family member 2 {ECO:0000313|Ensembl:ENSOCUP00000003277} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=MAPRE2 OC=Oryctolagus.
Sequence
MPGPTQTLSPNGENNNDIIQDNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRH
DIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLL
QASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWKKFYDANYDGKEYDPVEARQGQDAIPPP
DPGEQIFNLPKKSHHANSPTAGAAKSSPASKPGSTPSRPSSAKRASSSGSASKSDKDLET
QVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMEVLYASEE
HEGHTDEPEAEEQAHDQQPQQQEEY
Download sequence
Identical sequences G1SKE0
9986.ENSOCUP00000003277 ENSOCUP00000003277 ENSOCUP00000003277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]