SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1TXY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1TXY3
Domain Number 1 Region: 5-90
Classification Level Classification E-value
Superfamily DEATH domain 2.83e-20
Family Pyrin domain, PYD 0.0037
Further Details:      
 
Domain Number 2 Region: 171-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000424
Family YjeE-like 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1TXY3
Sequence length 257
Comment (tr|G1TXY3|G1TXY3_RABIT) Uncharacterized protein {ECO:0000313|Ensembl:ENSOCUP00000021941} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN= OC=Oryctolagus.
Sequence
GACATVARELLLATLEDLSQEQLKRFRHKLRDARTGSRSIPWGRLELADALELAEQLVHF
YGPEPALDVARATLKRADVRDVAARLKEQRLQRKLGARAGVLGGAAEYAKKYREHVLRQH
AKVRERNARSVRLDRRFTKLLIAPEARGDPAPEAAQESQKGAARRSDTRTFNRLFGRDDE
GQRPLTVVLQGPAGIGKTMAARKILYDWAAGKLYQGQVDFAFFVPCRELLGRPDERSLAD
LILDQCPDPGAPLPQML
Download sequence
Identical sequences G1TXY3
ENSOCUP00000021941 ENSOCUP00000021941 9986.ENSOCUP00000021941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]