SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1U7B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1U7B8
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.15e-46
Family Capz alpha-1 subunit 0.000000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1U7B8
Sequence length 212
Comment (tr|G1U7B8|G1U7B8_RABIT) Uncharacterized protein {ECO:0000313|Ensembl:ENSOCUP00000025320} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN= OC=Oryctolagus.
Sequence
DQFMPVKTEAYEGQVLMTEHSDLVNNRCLDPRNKIPLKSDYLSKETYDPQPKEVDGGLNS
CRESCNGALRAYAQTTDGQQIIIACIEGTRFSLKTSNHHWRSEWKFTIIPPTGQLGVLKI
QIHHYKDGNVQFVGHKDIQDSITMLNELQTVKWFIKIIDNAENEYQTTISENYKTISDIT
LKTLLPQLPSLCTKREWNKILSYKIEKEMHNV
Download sequence
Identical sequences G1U7B8
ENSOCUP00000025320 9986.ENSOCUP00000025320 ENSOCUP00000025320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]