SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2IUT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G2IUT9
Domain Number - Region: 20-70
Classification Level Classification E-value
Superfamily KaiA/RbsU domain 0.0752
Family Circadian clock protein KaiA, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G2IUT9
Sequence length 117
Comment (tr|G2IUT9|G2IUT9_PSEUL) Uncharacterized protein {ECO:0000313|EMBL:BAK77441.1} KW=Complete proteome; Reference proteome OX=748280 OS=Pseudogulbenkiania sp. (strain NH8B). GN=NH8B_2642 OC=Chromobacteriaceae; Pseudogulbenkiania.
Sequence
MYFVDRSVAVIKPKEPFLNWLNNVPGNDTDLTLDSLRADCTVILLPEFTDPEEGVSRIDD
MADQLFKIELASWYEDEALWPTDRSLKAFWEWFDVEIHSTVLDSVDEDIHNYPAAEL
Download sequence
Identical sequences B9Z2K0 G2IUT9
WP_008953583.1.44026 WP_008953583.1.76262 gi|347540430|ref|YP_004847855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]