SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2Q6S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2Q6S6
Domain Number 1 Region: 5-283
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-86
Family Capz beta-1 subunit 0.000000063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G2Q6S6
Sequence length 285
Comment (tr|G2Q6S6|G2Q6S6_MYCTT) Uncharacterized protein {ECO:0000313|EMBL:AEO53904.1} KW=Complete proteome; Reference proteome OX=573729 OS=(Sporotrichum thermophile). GN=MYCTH_2088191 OC=Thermothelomyces.
Sequence
MTTPDPFDSALDLLRRLNPKHTAEHLNNIITLAPDLTEDLLSSVDQPLTVCRCKQTGRDY
LLCDYNRDGDSYRSPWSNQFDPPLDEAGPGGVGPGGSNEGAGEGAVPGERVRKMEIKANE
AFDVYRELYYEGGVSSVYLWNLDDGFAGVVLLKKASTPSDGASSGVWDSIHVFEASERGR
TANYRLTSTVILSLATKGATLGEVDLSGNMTRQVEQDLPVENDESHIANIGRLVEDMELK
MRNLLQEVYFGKAKDVVGDLRSIGSLSENQRDRETQRELIGSMRR
Download sequence
Identical sequences G2Q6S6
XP_003659149.1.50100 jgi|Spoth1|76655|estExt_Genewise1Plus.C_21983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]