SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2QHI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2QHI4
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-80
Family Capz alpha-1 subunit 0.00000681
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G2QHI4
Sequence length 269
Comment (tr|G2QHI4|G2QHI4_MYCTT) Uncharacterized protein {ECO:0000313|EMBL:AEO58844.1} KW=Complete proteome; Reference proteome OX=573729 OS=(Sporotrichum thermophile). GN=MYCTH_2063277 OC=Thermothelomyces.
Sequence
MSSHKAIVSSFVEGAPPGEARNIKALTISSPGLVNELGPAFQKYNEEQFTTVKLPGGSQP
VIISSHSALGNGRYYDLESSCSFAFDHITQKASAVESYVPEGDGVDLAKSILKGLSTYVN
EHFTNAAYGAYPIENGSKIAIIIVANKYSPNNFWNGRWRSLYIFNPASSALEGSIKVDVH
YYEDGNVRLLTNKSATATVPSGTGAAIAKEISAGERKYQEELNRSFTSLSEGAFKALRRQ
LPVTRQKIEWDKVASYRLGQDIGGGSSRR
Download sequence
Identical sequences G2QHI4
XP_003664089.1.50100 jgi|Spoth1|51543|e_gw1.5.2228.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]