SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2WGB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2WGB2
Domain Number 1 Region: 2-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-69
Family Capz beta-1 subunit 0.000000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G2WGB2
Sequence length 287
Comment (tr|G2WGB2|G2WGB2_YEASK) K7_Cap2p {ECO:0000313|EMBL:GAA24081.1} KW=Complete proteome OX=721032 OS=yeast). GN=SYK7_035441 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSDAQFDAALDLLRRLNPTTLQENLNNLIELQPNLAQDLLSSVDVPLSTQKDSADSNREY
LCCDYNRDIDSFRSPWSNTYYPELSPKDLQDSPFPSAPLRKLEILANDSFDVYRDLYYEG
GISSVYLWDLNEEDFNGHDFAGVVLFKKNQSDHSNWDSIHVFEVTKSPSSPDSFNYRVTT
TIILHLDKIKTDQNSHMMLSGNLTRQTEKDIAIDMSRPLDVIFTSHVANLGSLIEDIESQ
MRNLLETVYFEKTRDIFHQTKNAAIASSAEEANKDAQAEVIRGLQSL
Download sequence
Identical sequences A0A250WMA7 G2WGB2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]