SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2YMM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2YMM8
Domain Number 1 Region: 1-168
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.01e-49
Family Capz beta-1 subunit 0.00000542
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G2YMM8
Sequence length 170
Comment (tr|G2YMM8|G2YMM8_BOTF4) Similar to F-actin capping protein beta subunit isoforms 1 and 2 {ECO:0000313|EMBL:CCD52876.1} KW=Complete proteome; Reference proteome OX=999810 OS=cinerea). GN=BofuT4_P138000.1 OC=Helotiales; Sclerotiniaceae; Botrytis.
Sequence
MEIRANEAFDVYRELYYEGGVSSVYFWNLDDGFAGVVLLKKVAPSSNSAGSWDSIHVFEA
VDRARTAHYKLTSTVILSLSTNGNELGEMDLSGNMTRQIEADLPIQDDAEHIANIGRLVE
DMELKMRNLLQEVYFGKAKDVVGDLRSLGSLSEGAKERKVRGEMLDAMKR
Download sequence
Identical sequences G2YMM8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]