SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2YMM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2YMM9
Domain Number 1 Region: 5-83
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.11e-26
Family Capz beta-1 subunit 0.0000694
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G2YMM9
Sequence length 92
Comment (tr|G2YMM9|G2YMM9_BOTF4) Uncharacterized protein {ECO:0000313|EMBL:CCD52877.1} KW=Complete proteome; Reference proteome OX=999810 OS=cinerea). GN=BofuT4_P138010.1 OC=Helotiales; Sclerotiniaceae; Botrytis.
Sequence
MAEVDQFDSALDLLRRLNPKHTTTHLNSLIDLVPSLTEDLLSSVDQPLTISRCRKTGRDY
LLCDYNRDGDSYRSPWSGEFETPVGGTTPGWY
Download sequence
Identical sequences G2YMM9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]