SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3AFW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3AFW9
Domain Number 1 Region: 4-272
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.11e-70
Family Capz beta-1 subunit 0.000000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3AFW9
Sequence length 285
Comment (tr|G3AFW9|G3AFW9_SPAPN) Uncharacterized protein {ECO:0000313|EMBL:EGW35108.1} KW=Complete proteome; Reference proteome OX=619300 OS=Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1). GN=SPAPADRAFT_58249 OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Spathaspora.
Sequence
MSYEDKFDASLDLLRRLDPRSIQTNLNDICTLVGDEELVQDLLSSVDTPLTTAQCGETGK
MYLCCDYNRDGDSYRSPWSNKYYPSISGDELPPYPSDLLRQLEIKANDSFDVYRDLYYEG
AGVSSVYLWDTAEDESAGLEEGFAGVVLFKKETEDGSGKWDSIHVFEVIPQSKTSILYKL
TSSVILDLQKSQGSSLSLSGNLTRQLETSQVVELEGGVNLETFHLINLGTLIEKSEYNIR
NLLQEVYFDKLKDIMLKDLRSIGDISDKKLEELRQQQIVKGLQSL
Download sequence
Identical sequences G3AFW9
XP_007372520.1.82671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]