SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3BB49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3BB49
Domain Number 1 Region: 2-154
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 1.01e-38
Family Arp2/3 complex 16 kDa subunit ARPC5 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3BB49
Sequence length 154
Comment (tr|G3BB49|G3BB49_CANTC) Actin-related protein 2/3 complex subunit 5 {ECO:0000256|RuleBase:RU004301} KW=Complete proteome; Reference proteome OX=590646 OS=NBRC 10315 / NRRL Y-1498 / VKM Y-70) (Yeast). GN=CANTEDRAFT_115610 OC=Yamadazyma/Candida clade.
Sequence
MEDWRRIDIDAFEPDKFLSKEELVPAIANPVDEAAIPSIIAECKAKLSKGQFAEALKTAL
QNPPYLSSPAAKASYDQLVFETLISVKNNNTDILPFVKQLSSDEQDTLVKYLYKIMDTSY
GSKQGAVLLAWYEKTVEFTGLGPVIRFMSDRRTV
Download sequence
Identical sequences G3BB49
XP_006688968.1.13517 XP_006688969.1.13517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]