SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3JGC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3JGC8
Domain Number 1 Region: 459-720
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.49e-86
Family Capz alpha-1 subunit 0.00000616
Further Details:      
 
Domain Number 2 Region: 77-263
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.65e-63
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000461
Further Details:      
 
Domain Number 3 Region: 269-404
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.77e-33
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3JGC8
Sequence length 729
Comment (tr|G3JGC8|G3JGC8_CORMM) 2-oxoisovalerate dehydrogenase beta subunit {ECO:0000313|EMBL:EGX93258.1} KW=Complete proteome; Reference proteome OX=983644 OS=Cordyceps militaris (strain CM01) (Caterpillar fungus). GN=CCM_04631 OC=Cordyceps.
Sequence
MVAAMPIQALGPFRQPRERPQQAESQSAWSSWTKPPVAAAVILFPTPLLLDPVSFTQLHK
SADAVQKNLEIPAEVRNGATKKMNLFQAVNDALGTALGEDESVVVFGEDVAFGGVFRCTM
KLAETHGTERVFNTPLSEQGILGFGIGLAAEGMRPVAEIQFADYVYPAFDQIVNEAAKMR
FRDGTNGRGAGGLTVRMPCGGVGHGALYHSQSPESLFTHVPGVRVIMPRSPIQAKGLLLS
AIRCNDPCIFMEPKILYRAAVEQVPVASYELPLSKAEVLKEGSNVTVISYGQPLYYCIEA
IRQIEAQRPDVSIELIDLRTVHPFDRETVFESVKKTGRVMIVHEAYTTAGIASEVAAAVQ
ENPDTFNRLEAPVRRVAGWDIHNSLAFERFHLPDITRVYDNIKRFKEQIDLITELPPLAV
RRLPRPRHAAATGCATHHCLLQDRRNAYLSQQDCIVSMSQLETVASFIEGAPPGELADVV
ADIKTLTASSPNLVSQLGPAFQKYNEEQLITVKLPGSSQFVLVSEHNNLGDGRYYDVESS
SSFAFDHATQKASAVQSHTIEGAQAELTHSTLKTLGTYISEHFPSAAYGVYPIEADSKVA
IIIVANKYSPNNFWNGRWRSVYTFDPSSSLLEGTIKVDVHYYEDGNVRLQTKKPVSVSIS
SGTGAGIAKEISSTERKYQEELNKGFVSLSEGAFKGLRRQLPITRQKIEWDKVTGYRLGQ
DIGGGSSKR
Download sequence
Identical sequences G3JGC8
XP_006669841.1.37481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]