SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3N7V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N7V7
Domain Number 1 Region: 3-221
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.93e-83
Family Capz beta-1 subunit 0.00000000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3N7V7
Sequence length 234
Comment (tr|G3N7V7|G3N7V7_GASAC) Capping protein (actin filament) muscle Z-line, beta {ECO:0000313|Ensembl:ENSGACP00000001391} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MNDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYEPPIEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTT
KTGSGTMNLGGSLTRQMEKDETVGESSPHIANIGRLVEECSQSGRQVKAGGSEG
Download sequence
Identical sequences G3N7V7
ENSGACP00000001391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]