SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3N7W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N7W0
Domain Number 1 Region: 3-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-96
Family Capz beta-1 subunit 0.00000000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3N7W0
Sequence length 274
Comment (tr|G3N7W0|G3N7W0_GASAC) Capping protein (actin filament) muscle Z-line, beta {ECO:0000313|Ensembl:ENSGACP00000001394} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MNDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYEPPIEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTT
KTGSGTMNLGGSLTRQMEKDETVGESSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSIESLPDNQKYRQLQKELSQVLTQRQIFID
Download sequence
Identical sequences G3N7W0
69293.ENSGACP00000001394 ENSGACP00000001394 ENSGACP00000001394 XP_008280920.1.38333 XP_008280921.1.38333 XP_018536882.1.34915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]