SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3P3C4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P3C4
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.02e-113
Family Capz alpha-1 subunit 0.000000000708
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3P3C4
Sequence length 286
Comment (tr|G3P3C4|G3P3C4_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000012097} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MADHEEQLSDEEKVRIAANFVIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKVEGYEEQVLITEHGDLGNGRVLDPKNKISFKFDHLRKEASDPRPQDVGGSLEGW
RSAVDSAVRAYVKEHYPSGVCTIYGKTIDGHQTIIVCIECHQFQPKNFWNGRWRSEWKFT
VSPSTTQVAGIMKIQVHYYEDGNVQLVSHKEVQESMSISNEASTAKEFVKIMEAAENDYQ
TAINENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences G3P3C4
ENSGACP00000012097 ENSGACP00000012097 69293.ENSGACP00000012097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]