SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3P775 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G3P775
Domain Number - Region: 113-151
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0131
Family Troponin I 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3P775
Sequence length 190
Comment (tr|G3P775|G3P775_GASAC) Schwannomin interacting protein 1 {ECO:0000313|Ensembl:ENSGACP00000013449} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MNLQICFVNDSGSDKDSDADDSKTETSLDTPLSPMSKQSSSYSDRDTTEEDSESLEDMDF
VSRQKKLQAEAKLALAMAKPMAKMQVEVEKQNRKKSPVADLLPHMPHISECLMKRSLKPT
DLRDMTLGQLQVIVNDLHSQIESLNEELVQLLLIRDELHMEQDAMLVDIEDLTRHAESQQ
KHLAERTLSK
Download sequence
Identical sequences G3P775
ENSGACP00000013449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]