SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3P778 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P778
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-111
Family Capz alpha-1 subunit 0.00000000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3P778
Sequence length 286
Comment (tr|G3P778|G3P778_GASAC) Capping protein (actin filament) muscle Z-line, alpha 1b {ECO:0000313|Ensembl:ENSGACP00000013452} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MADFEEPLSDDEKVRIAANFVTHAPPGEFNEVFNDVRLLLNNDNLLREGASHSFAQYNMD
QFTPAKLEGYDEPVLITEHGDLGQGRFLDPRNRLVFRFDHLRKEVSDVQPYEGETPLRSW
REACDTSLSAYVKEHYPTGVCTVYGKTVDGQQTIIACIEGHQFQPKNFWNGRCRSEWKLT
IGQSTAQVVGVLKIQVHYYEDGNVQLVSHKEVEESIPVTNESQTTKEFVDIIENAENDYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences G3P778
69293.ENSGACP00000013452 ENSGACP00000013452 ENSGACP00000013452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]