SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PC21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PC21
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.98e-48
Family Calponin-homology domain, CH-domain 0.000000471
Further Details:      
 
Domain Number 2 Region: 186-248
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 3.14e-22
Family EB1 dimerisation domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PC21
Sequence length 266
Comment (tr|G3PC21|G3PC21_GASAC) Microtubule-associated protein, RP/EB family, member 3a {ECO:0000313|Ensembl:ENSGACP00000015145} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MAVNVYATSVSIDNLSRHDMLAWVNDSLHLTYTKIEQLCSGAAYCQFMDMLFPGCILLKK
VKFQAKLEHESIHNFKVLQAAFKRMSVDKIIPVEKLVKGKFQDNFEFVQWFKKFFDANYD
GKEYDPLLSRQGQDVAPAPNPGDHFIHKPKRTPVPKNMPTPQRVQHNTPAMRKNPSLSRN
GGSDAEIMELNQQLMELKLTVDGLEKERDFYFSKLRDIELICQEHESENNSVLSSIINIL
YATEDGFAPPEDEDLDEQAHLDQDEY
Download sequence
Identical sequences G3PC21
ENSGACP00000015145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]