SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PI56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PI56
Domain Number 1 Region: 66-98
Classification Level Classification E-value
Superfamily Notch domain 0.000000772
Family Notch domain 0.0029
Further Details:      
 
Domain Number 2 Region: 27-58
Classification Level Classification E-value
Superfamily Notch domain 0.00000157
Family Notch domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PI56
Sequence length 233
Comment (tr|G3PI56|G3PI56_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000017283} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MLALRTFVLLGLSWTCRAASGDPWGQCPVNRKCKDKFGNGSCDNECMEPECLRDGFDCLK
DRGHCNPGHIQYCRDHYANSHCEQGCDSAPCGWDGSDCFTHRSPMWARGTLVLHASLPAH
RGAFANSSLLWALSVLLQSPLKLRGSAPLATGRNLFDFDAQQLADLLAQASAGDSNGSLL
FLQVDNRPCTSQPSTCFPYATEAASFLRAVMLLKPGWFSSLPELKAVVSIRGV
Download sequence
Identical sequences G3PI56
69293.ENSGACP00000017283 ENSGACP00000017283 ENSGACP00000017283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]