SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RL66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RL66
Domain Number 1 Region: 14-143
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.17e-51
Family Calponin-homology domain, CH-domain 0.00000035
Further Details:      
 
Domain Number 2 Region: 199-261
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 6.54e-22
Family EB1 dimerisation domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3RL66
Sequence length 279
Comment (tr|G3RL66|G3RL66_GORGO) Microtubule associated protein RP/EB family member 3 {ECO:0000313|Ensembl:ENSGGOP00000016504} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=MAPRE3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MWSLKSEQRQSWGMAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQF
MDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEF
IQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPVPQRTSPTGPKNMQTSGRLSNVAPPC
ILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHES
ENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY
Download sequence
Identical sequences G3RL66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]