SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3SLB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SLB7
Domain Number 1 Region: 2-269
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-113
Family Capz alpha-1 subunit 0.00000000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SLB7
Sequence length 274
Comment (tr|G3SLB7|G3SLB7_LOXAF) Capping actin protein of muscle Z-line alpha subunit 1 {ECO:0000313|Ensembl:ENSLAFP00000000194} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=CAPZA1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
VRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYEDQ
VLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEDIDGGLKSWRESCDSALRAYVK
DHYSNGFCTVVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVL
KIQVHYYEDGNVQLVSHKDVQDSVTVSNEVQTAKEFIKIIEHAENEYQTAISENYQTMSD
TTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences G3SLB7
ENSLAFP00000000194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]