SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3T5L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T5L5
Domain Number 1 Region: 31-297
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.19e-98
Family Capz beta-1 subunit 0.000000000431
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3T5L5
Sequence length 301
Comment (tr|G3T5L5|G3T5L5_LOXAF) Capping actin protein of muscle Z-line beta subunit {ECO:0000313|Ensembl:ENSLAFP00000008732} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=CAPZB OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MHPSRRSLPFPLNCQLVRVGTADYGGASDQSDQQLDCALDLMRRLPPQQIEKNLSDLIDL
VPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSA
RLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSI
HVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIA
NIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQ
C
Download sequence
Identical sequences A0A287DAY1 G3T5L5
ENSLAFP00000008732 ENSLAFP00000008732 XP_004397117.1.74151 XP_005617941.1.84170 XP_010591353.1.64505 XP_019651304.1.58354 XP_020020973.1.5219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]