SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UB24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UB24
Domain Number 1 Region: 6-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.14e-82
Family Capz alpha-1 subunit 0.0000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3UB24
Sequence length 299
Comment (tr|G3UB24|G3UB24_LOXAF) Capping actin protein of muscle Z-line alpha subunit 3 {ECO:0000313|Ensembl:ENSLAFP00000025032} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=CAPZA3 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MSLTVLSRRQKEKVIRRLLIQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYS
VPLCIDGNPVLLSHHNVVGDYRFFDYQSKLSFKFDLLQNQLKDIQSHGIIRNETEYLRTV
VLCALKLYVNDHFPRGNCNVLRKTVKNKEFLIACIEDHNYESGDYWNALWKSKWIFQINP
FLTQVTGRIFVQAHYFRCVNLHVKISKDLKESLEVVNQAQLALNFARLVEEQENKFQTAV
LEELQELSNEALRKILRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII
Download sequence
Identical sequences G3UB24
XP_003405725.1.64505 ENSLAFP00000025032 ENSLAFP00000025032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]