SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3V7Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3V7Y8
Domain Number 1 Region: 47-162
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.000000319
Family Deoxycytidylate deaminase-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3V7Y8
Sequence length 198
Comment (tr|G3V7Y8|G3V7Y8_RAT) Activation-induced cytidine deaminase {ECO:0000313|EMBL:EDM01989.1, ECO:0000313|Ensembl:ENSRNOP00000020762} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_29802 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSFSLDFGHLRNKSGCHVELL
FLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRK
AEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENHERTFKAWEGLHENSVRLTRQLRRIL
LPLYEVDDLRDAFRILGL
Download sequence
Identical sequences G3V7Y8
NP_001094249.1.100692 NP_001094249.1.4139 XP_007626999.1.28591 XP_007648006.1.69978 10116.ENSRNOP00000020762 ENSRNOP00000020762 ENSRNOP00000020762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]