SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G4N6W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4N6W5
Domain Number 1 Region: 69-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.27e-58
Family Capz alpha-1 subunit 0.0000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G4N6W5
Sequence length 273
Comment (tr|G4N6W5|G4N6W5_MAGO7) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EHA50729.1} KW=Complete proteome; Reference proteome OX=242507 OS=blast fungus) (Pyricularia oryzae). GN=MGG_12818 OC=Magnaporthe.
Sequence
MTKSTEGRCDFLVASRAVSYQDTFAFGVAPHSVAYSDNADAPFFHNSYPRLAIAPVKTTS
QTSSLLRSRRIDIKSISSGDAKVVSKLAPAFERYNEEQFTTVKLPGGSQKVIVSAHNSLG
DGRYYDVESSSSFAFDHTTQKASAVQSYALESAHSDLVNGRWRSLYTLDPASGAIDGSIK
VDVHYYEDGNVRLLTDKATTATVPSATGSAIVKEIGSSEKKYQEELNRGFTDLSEGAFKG
LRRQLPVTRQKIEWDKVASYRLGQDIGGGRRQG
Download sequence
Identical sequences G4N6W5
MGG_12818T0 XP_003717048.1.18062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]