SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G4T922 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4T922
Domain Number 1 Region: 3-272
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-82
Family Capz alpha-1 subunit 0.00000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G4T922
Sequence length 284
Comment (tr|G4T922|G4T922_SERID) Related to CAP1-F-actin capping protein alpha subunit {ECO:0000313|EMBL:CCA67800.1} KW=Complete proteome; Reference proteome OX=1109443 OS=(Piriformospora indica). GN=PIIN_01624 OC=Agaricomycetes; Sebacinales; Serendipitaceae; Serendipita.
Sequence
MNAQERVNAAANLLVQSPPGEINDCLTDIRVIINDDNLLQQGIDQALREYNIAQFVTVQS
PKGDHHVIISDAGRVGGDTEDRFFDPRTKTSFFFDHLSLEASDPNTEEANEDIEGYRAAL
DSAAQEYINEHYKEGVTSVFASGSNNLTIQLVANRYNPQNFWSGRWRSRYEIDLDAKTVT
GKILVTVHYYEQGNVQLTTEFTPTLTLPPSSPSPQAARQLIAQITEQENTYQTSLSDTYH
DLGEKRFKTLRRALPMTRNKIDWDKVTGYKLGAELTASRGGFGS
Download sequence
Identical sequences G4T922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]