SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G4TJ26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4TJ26
Domain Number 1 Region: 5-272
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-83
Family Capz beta-1 subunit 0.0000000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G4TJ26
Sequence length 276
Comment (tr|G4TJ26|G4TJ26_SERID) Probable F-actin capping protein beta subunit {ECO:0000313|EMBL:CCA71309.1} KW=Complete proteome; Reference proteome OX=1109443 OS=(Piriformospora indica). GN=PIIN_05248 OC=Agaricomycetes; Sebacinales; Serendipitaceae; Serendipita.
Sequence
MGDVLDSMLDLMRRLPPTRIEENLNALLGMCPEYADDLLGSVDQPLKLLTDKSTGREYLA
CDYNRDGDSYRSPWSNEYDPPLEDGTVPSAKLRRLEIAANDAFDTYREMYYEGGVSSVFL
WDQDDGGFAGVVLFRKVISPDASGQAPDGTSEDATGSWQSIHVFEASERGRTAHYKLTST
VMLELVTKSAGVGDVNLSGSLTRQNEVDASISDQSSHIANTGRMIEDMEIKMRNLLQEVY
FGKTRDIVYDLRSVEGLERAKQQRALQKELVGLIKR
Download sequence
Identical sequences G4TJ26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]