SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G4U9J3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4U9J3
Domain Number 1 Region: 5-279
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-84
Family Capz beta-1 subunit 0.000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G4U9J3
Sequence length 289
Comment (tr|G4U9J3|G4U9J3_NEUT9) F-actin capping protein beta subunit {ECO:0000313|EMBL:EGZ78557.1} KW=Complete proteome; Reference proteome OX=510952 OS=Neurospora tetrasperma (strain FGSC 2509 / P0656). GN=NEUTE2DRAFT_143255 OC=Neurospora.
Sequence
MATADPFDSALDLLRRLNPKHTAEHLNNLITLAPDLTEDLLSSVDQPLTVKRCKQTGRDY
LLCDYNRDGDSYRSPWSNQFDPPLEGGNQGGSGGDGEGDGGEGGAAGSIMPGERVRKMEI
KANEAFDVYRELYYEGGVSSVYFWNLDDGFAGVVLLKKSSPTNPSSSGVWDSIHVFEASE
RGRTSNYRLTSTVILSLATKGNALGEVDLSGNMTRQVEQDLPVENDESHIANIGRLVEDM
ELKMRNLLQEVYFGKAKDVVGDLRSVGSLSEGQRDRDAQMEIIGSMRKA
Download sequence
Identical sequences A0A0B0DGC3 F8MYR4 G4U9J3 Q7SCP4
NCU07471T0 jgi|Neute1|189168|estExt_fgenesh2_kg.C_70120 XP_009855100.1.73169 XP_963750.2.24337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]