SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G4VBQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4VBQ9
Domain Number 1 Region: 1-51
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000000102
Family Capz beta-1 subunit 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G4VBQ9
Sequence length 54
Comment (tr|G4VBQ9|G4VBQ9_SCHMA) Putative f-actin capping protein beta subunit {ECO:0000313|EMBL:CCD77333.1} KW=Complete proteome; Reference proteome OX=6183 OS=Schistosoma mansoni (Blood fluke). GN=Smp_100370 OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
DVENSIRSTLNEVYFGTTKNIVDSLRSIVPASEEEKRRRLVQEVHTALQNKSQL
Download sequence
Identical sequences G4VBQ9
Smp_100370 XP_018649957.1.29077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]