SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G4VBT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4VBT5
Domain Number 1 Region: 38-238
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-67
Family Capz beta-1 subunit 0.000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G4VBT5
Sequence length 242
Comment (tr|G4VBT5|G4VBT5_SCHMA) Putative f-actin capping protein beta subunit {ECO:0000313|EMBL:CCD77359.1} KW=Complete proteome; Reference proteome OX=6183 OS=Schistosoma mansoni (Blood fluke). GN=Smp_186650 OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MHQNLHFSLKTTCSTPALGMGSGGAYSEVCATAMDMANPLTSVMDLMRRLPPQKINHTLV
DVISLKPEHCEDILSSVDQPLKIARDVHADRDYLLCDYNRDGDSYRSPWSNTYDPPLEDG
AMPSESLRKREIEINTAFDQYREMYYEGGISSVYLWDMDHGFAGVILIKKAGNAKLASGC
WDSIHVIDVVERPSAKISLYKLTSTVMLWLQTQRESAGYFNLGGSLSRFSERELPLGDSG
FQ
Download sequence
Identical sequences G4VBT5
XP_018649983.1.29077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]