SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AJ87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5AJ87
Domain Number - Region: 43-124
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.034
Family Capz beta-1 subunit 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5AJ87
Sequence length 132
Comment (tr|G5AJ87|G5AJ87_PHYSP) Uncharacterized protein {ECO:0000313|EMBL:EGZ04418.1} KW=Complete proteome; Reference proteome OX=1094619 OS=(Phytophthora megasperma f. sp. glycines). GN=PHYSODRAFT_536480 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MTCKFITKKDTQCTREAKKGDYCTQHHNIIQIKMYKKELSIIHKKNRILSEENKELQKYK
HQINTINEFDLIKQQLIQINPYMKFKYLIVDRRYQSRLEEVFNVPFDQIEKKYRKLLYER
NDLCHPYTSRYW
Download sequence
Identical sequences G5AJ87
XP_009540138.1.77131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]