SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5B2Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5B2Y6
Domain Number - Region: 92-125
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0654
Family RILP dimerisation region 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5B2Y6
Sequence length 154
Comment (tr|G5B2Y6|G5B2Y6_HETGA) Pre-mRNA-splicing factor 38A {ECO:0000313|EMBL:EHB03647.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_14536 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MLQIQPEKEIIIEFLKNEDCKYVRLLGALYTRLTGTAIDCYKYLEPLYKDYRKIKSQKQN
GELELMHVDDFIDVLLHSETVCEIILPRLQKRYVLQEAEQLEPRVSALEEDMEDVESSEE
EEEDDEKLESVRSPGHGRRSYRDLDEPQGSPTLR
Download sequence
Identical sequences G5B2Y6
HGL_H00000257181-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]