SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BG38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BG38
Domain Number 1 Region: 73-143
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.72e-28
Family Capz alpha-1 subunit 0.0000591
Further Details:      
 
Domain Number 2 Region: 8-73
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.32e-17
Family Capz alpha-1 subunit 0.0000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BG38
Sequence length 242
Comment (tr|G5BG38|G5BG38_HETGA) F-actin-capping protein subunit alpha-2 {ECO:0000313|EMBL:EHB08249.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_17180 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MADLEEQLSDEEKVRIAAKFIFHAPLGEFNEVFNDVRLLLNNDNLLREKAAHAFAQYNSD
QFTPVKIKGYEDQVHYYEDGNVQLVSHKDTQDSLTVSNDVQTAKEFIKIVETAENEYQTA
ISENYQTRSNTTFKALRRQLPATWFHTTKTQRTPDHQTTVLGKLESSSPPISTGSIFKGR
AAGTCNTALQSSILQEDRELNLGLAARNLPESHGSATSFLRLIDLCLHTATHVVYCDSRD
IP
Download sequence
Identical sequences G5BG38
HGL_H00000263168-4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]