SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BQF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5BQF2
Domain Number - Region: 16-74
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0502
Family Troponin I 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BQF2
Sequence length 105
Comment (tr|G5BQF2|G5BQF2_HETGA) Short coiled-coil protein {ECO:0000313|EMBL:EHB11513.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_13073 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MFLFCFVGYSRILYPRPRSLLSKMMNADMDAVDAENQVELEEKTRLINQVLELQHTLEDL
SARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK
Download sequence
Identical sequences G5BQF2
HGL_H00000377751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]