SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5CQH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5CQH5
Domain Number - Region: 72-105
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0902
Family Moesin tail domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5CQH5
Sequence length 127
Comment (tr|G5CQH5|G5CQH5_9VIRU) Uncharacterized protein mg1071 {ECO:0000313|EMBL:AEQ33144.1} KW=Complete proteome; Reference proteome OX=1094892 OS=Megavirus chiliensis. GN=mg1071 OC=unclassified Mimiviridae.
Sequence
MPSKIRRNKPNKTYNEFHPFCYREFGVTTNKYKILQKIVKLSNTAYIIKRIINEIRNRYP
NQDPRVSRIIQKFTTKIRYLEKNIAQMKNQTRGCSFDSVHHDSIHNDSIHNDIFTQISFL
HQLVRDG
Download sequence
Identical sequences G5CQH5
YP_004895122.1.51275 gi|363540535|ref|YP_004895122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]