SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5E3I5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5E3I5
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-55
Family Capz alpha-1 subunit 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5E3I5
Sequence length 127
Comment (tr|G5E3I5|G5E3I5_9PIPI) Putative F-actin capping protein alpha 1 {ECO:0000313|EMBL:AEQ17261.1} OX=191480 OS=Pipa carvalhoi (Carvalho's Surinam toad). GN= OC=Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Pipinae; Pipa.
Sequence
QQTIIACIESHQFQPKNFWNGRWRSEWKFTVSQSSAQLVGVLKIQVHYYEDGNVQLVSHK
DVQESLTISGESQTAKEFVKIIEQAENEYQTAISENYQTMSDTTFKALRRQLPVTRTRID
WNKLSYK
Download sequence
Identical sequences G5E3I5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]