SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5K9W4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5K9W4
Domain Number - Region: 29-95
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0254
Family Capz beta-1 subunit 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5K9W4
Sequence length 504
Comment (tr|G5K9W4|G5K9W4_9STRE) M protein trans-acting positive regulator (MGA) PRD domain protein {ECO:0000313|EMBL:EHI65581.1} KW=Complete proteome OX=875093 OS=Streptococcus pseudoporcinus LQ 940-04. GN=STRPS_0536 OC=Streptococcus.
Sequence
MLEHYLEKPIVDKKVLLTFFLDKRQILVSELISETELSYNLIKQYCQELNEQFSQSLKIE
VSPQIITTTYNEQLKDHYFFDLYAQSNLLQLLRFLLLNEDSQKPLTYFAERSFISNASAY
RMREAIRPYLKEIGLALHKNVIRGDEYRIRFLIALLQSKFGIIIYEFSQEDFHVIDQFIA
NSASSLKFSNLLEHSFQFYNTLLALSWKRFDYRVSLPKSDIFNELKQIFIYQKISETATA
TIERQLHLSFNTSDIDYLFLIYILANNSFASQDWTVEEVDFYISIFEKNYHFQLLLNPLK
KLFDIPQQKEKEFVRIVLAFAKDHIYQLEPFIPEKNYFLSNYCSENSLLKEAIFKIVKKW
KKEIKQSAQVNARHLNLFCNHLELFLKSYQPPLQLVFLSTDFTSSMTLTDFIANRFSSDY
VQFHSYYLLTDDIYQIADIKPHLMVTSHQLIPFIEHEIISGIPILDFSHNNLETNTRQLQ
DTIARLKAEQFSNFLKQQIQLTEA
Download sequence
Identical sequences G5K9W4
WP_007896507.1.90177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]