SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5S2M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5S2M2
Domain Number 1 Region: 21-182
Classification Level Classification E-value
Superfamily MtlR-like 2.09e-57
Family MtlR-like 0.00002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5S2M2
Sequence length 204
Comment (tr|G5S2M2|G5S2M2_SALET) Mannitol operon repressor {ECO:0000313|EMBL:EHC98388.1} KW=Complete proteome OX=913084 OS=Salmonella enterica subsp. enterica serovar Urbana str. R8-2977. GN=LTSEURB_5562 OC=Enterobacteriaceae; Salmonella.
Sequence
QVSLRPNNRLSDMQAIMEQTQAFENRVLERLNAGKTVRSFLITAVELLTEAVNILVLQVF
RKDDYAVKYAVEPLLDGDGPLGDLSVRLKLIYGLGVLSRTEYEDAELLMALREELNHDGN
EYAFTDDEILGPFGELHCVMALPPPPHFDTSDAALYAMQIQRYQQAVRSTMVLSLTELIS
KIKILVEFFPELISKISLKKAFQK
Download sequence
Identical sequences G5S2M2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]