SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7KXI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7KXI8
Domain Number 1 Region: 11-294
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-83
Family Capz alpha-1 subunit 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7KXI8
Sequence length 305
Comment (tr|G7KXI8|G7KXI8_MEDTR) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:AES82427.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_7g112700 OC=Trifolieae; Medicago.
Sequence
maeeeeeselsekqkveiakwfllnsppgeiqyvakdvksilnddgsfneaaseafpiyn
kshfivlsmpdrsgdvlvtsygelednayldprtaqvaivdhvkqvctevrpaldeelps
ayieefrfsldaeilkyveevypkgvcsvycvngkdtegpgsdfelavvisaarhspqnf
cngswcsiwnidfkddqqtvevkgklqvgahyfeegnvqldakheckdatlfqapddcai
aissiirhheteylasleasylnlpdstfkdlrrklpvtrtlfpwhntlqfslsrdiske
lgigk
Download sequence
Identical sequences G7KXI8 H2D5S1
XP_003626209.1.50012 Medtr7g112700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]