SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7ME97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7ME97
Domain Number 1 Region: 25-100
Classification Level Classification E-value
Superfamily Apolipoprotein A-II 9.02e-36
Family Apolipoprotein A-II 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7ME97
Sequence length 100
Comment (tr|G7ME97|G7ME97_MACMU) Uncharacterized protein {ECO:0000313|EMBL:EHH15444.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_01534 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MKLLAATVLLLTICSLEGALVRRQAEEPSVESLVSQYFQTVTDYGKDLMEKVKSPELQAQ
AKAYFEKSKEQLTPLVKKAGTDLVNFLSYFVELRTQPATQ
Download sequence
Identical sequences A0A2K5I225 A0A2K5N980 A0A2K5YTJ4 A0A2K6ALU4 A0A2K6L0I1 G7ME97 G7NXA8 P0DP85 P0DP86 P0DP87 P18656
ENSMMUP00000006019 ENSMMUP00000006019 XP_001117975.1.72884 XP_005541251.1.63531 XP_010365434.1.97406 XP_011768466.1.29376 XP_011812962.1.43180 XP_011812963.1.43180 XP_011831526.1.47321 XP_011831534.1.47321 XP_011922905.1.92194 XP_017716344.1.44346 9544.ENSMMUP00000006019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]