SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7MII2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7MII2
Domain Number 1 Region: 8-227
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.02e-86
Family Capz alpha-1 subunit 0.0000000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7MII2
Sequence length 232
Comment (tr|G7MII2|G7MII2_MACMU) Uncharacterized protein {ECO:0000313|EMBL:EHH15061.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_01099 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNVRLLLNNDNLLREGAAHAFAQYNMDQ
FTPVKIEGYEDQVLITEHGDLGNSRFLDVYAKTIDGQQTIIACIESHQFQPKNFWNGRWR
SEWKLTITPPTGQVVGVLKIQVHYYEDGNVQLVSHKDVQDSLTVSNEAQTAKEFIKIIEN
AENERQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences G7MII2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]