SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7PKM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7PKM9
Domain Number 1 Region: 9-245
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.19e-85
Family Capz alpha-1 subunit 0.00000000565
Further Details:      
 
Domain Number 2 Region: 2251-2364
Classification Level Classification E-value
Superfamily Bromodomain 3.66e-36
Family Bromodomain 0.00015
Further Details:      
 
Domain Number 3 Region: 2117-2188
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.66e-18
Family PHD domain 0.0017
Further Details:      
 
Domain Number 4 Region: 955-1002
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000036
Family Methyl-CpG-binding domain, MBD 0.028
Further Details:      
 
Weak hits

Sequence:  G7PKM9
Domain Number - Region: 817-871
Classification Level Classification E-value
Superfamily ARM repeat 0.000155
Family GUN4-associated domain 0.076
Further Details:      
 
Domain Number - Region: 1452-1499
Classification Level Classification E-value
Superfamily ARM repeat 0.00368
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7PKM9
Sequence length 2371
Comment (tr|G7PKM9|G7PKM9_MACFA) Uncharacterized protein {ECO:0000313|EMBL:EHH54888.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_03990 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MANFVDCVLDEEKVRIATEFITHAPPGEFNEVFSDVWLLRNNDNLLRERAEHAFAHYNVN
QFTPVKIEGYEDQVLITEHGDLGNSRVLDPRNNFSFKFDHLQKEASDPQPEQVDGDRYSN
CFCIVYAKTIDGQQTIIACIESHQSQPKNLWNGRWRSEWKLTITPPTGQVVGVLKIQVHY
YEDGNVQLVSHKDVHDSLTVSNDTQTAKEFIKIIENAENEHQTAISENYQTMSDTTFKVL
RWQLPGHLFRTAGDQPFNLSTVSSAFPMVSHPVFGLHSASSGHSEFGGLGTLGTPTALAA
HPQLASFPGVNGSINGNNTSSVIGINTSVLSTTASSSMGQTKSTSSGGGNRKCNQEQSKN
QPLDARVDKIKDKHVYFYFQGVNGSINGNNTSSVIGINTSVLSTTASSSMGQTKSTSSGG
GNRKCNQEQSKNQPLDARVDKIKDKKPRKKAMESSSNSDSDSGTSSDTSSEGISSSDSDD
LEEDEEEEDQSIEESEDDDSDSESEAQHKSNNQVLLHGISDPKADGQKATEKAQEKRIHQ
PLPLVSESQTHSSFQSQQKQPQVLSQQLPFIFQSSQAKEESVNKHTSVIQSTGLVSNVKP
LSLVNQAKKETYMKLIVPSPDVLKAGNKNTSEESSSLTSELRSKREQYKQAFPSQLKKQE
SSKSLKKVIAALSDPKATSSSPAHPKQILENNHPNPFLTNALLGNHQPNGVIQSVIQEAP
LALTTKTKMQSKINENIAAASSTPFSSPVNLSTSGRRTPGNQTPVMPSASPILHSQGKEK
AVSNNVNPVKTQRHSHPAKPLVEQFRGTDSDIPSSKDSEDSNEDEEEDDEEEDEEDDEDD
ESDDSQSESDSNSESDTEGSEEEDDDDKDQDESDSDTEGEKTSMKLNKTTSSVKSPSMSL
TAHSTPRNLHIAKAPGSAPAALCSESQLPAFLGTSSSTLTSSPHSGTSKRRRVTDERELR
IPLEYGWQRETRIRNFGGRLQGEVAYYAPCGKKLRQYPEVIKLWARMDTENMKDQYQKSK
SLEIYVTDLPEEDVIPRIRAMEGRRGRPPNPDRQRAREESRMRRRKGRPPNVGNAEFLDN
TDAKLLRKLQAQEIARQAAQIKLLRKLQKQEQARVAKEAKKQQAIMAAEEKRKQKEQIKI
MKQQAKKKKKEEAANAKLLEAEKRIKERERRRQHMMLMKAMEARKKAEEKERLKQEKRDE
KRLNKERKLEQRRLELEMAKELKKPNEDMCLADQKPLPELPRIPGLVLSGSTFSDCLMVV
QFLRNFGKVLGFDVNIDVPNLSVLQEGLLNIGDSMGEVQDLLVRLLSAAVCDPGLITGYK
AKTALGEHLLNVGVNRDNVSEILQIFMEAHCGQTELTESLKTKAFQAHTPAQKASVLAFL
INELACSKSVVSEIDKNIDYMSNLRRDKWVVEGKLRKLRIIHAKKTGKRDTSSGIDLGEE
QHPLGTPTPGRKRRRKGGDSDYDDDDDDDSDDQGDEDDEDEEDKEDKKGKKTDICEDEDE
GDQAASVEELEKQIEKLSKQQSQYRRKLFDASHSLRSVMFGQDRYRRRYWILPQCGGIFV
EGMESGEGLEEIAKEREKLKKAESVQIKEEMFETSGDSLNCSNTDHCEQKEDLKEKDNTN
LFLQKPGSFSKLSKLLEVAKMPPESEVITPKPNAGANGCTLSYQNSGKHSLGSVQSTATQ
SNVEKADSNNLFNTGSSGPGKFYSPLPSDQLLKTLTEKNRQWFSLLPRTPCDDTSLTHAD
MSTASLVTPQSQPPSKSPSPAPAPLGSSTQNPVGLNPFALSPLQVKGGVSMMGLQFCGWP
TGVLTSNIPFASSVPGLGSGLGLSEGNGNSLLTSTVASSKSESPVPQNEKATSAQPAAVE
VAKPVDFPSPKPIPEEMQFGWWRIIDPEDLKALLKVLHLRGIREKALQKQIQKHLDYITQ
ACIKNKDVAIIELNENEENQVTRDIVENWSVEEQAMEMDLSVLQQVEDLERRVASASLQV
KGWMCPEPASEREDLVYFEHKSFTKLCKEHDGEFTGEEESSAHALERKSDNPLDIAVTRL
ADLERNIERRYLKSPLSTTIQIKLDNVGTVTVPAPAPSISGDGDGIEEDIAPGLRVWRRA
LSEARSAAQVALCIQQLQKSIAWEKSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHR
PKITTIPDGDWFCPACIAKASGQTLKIKKLHVKGKKTNESKKGKKVTLTGDTEDEDSAST
SSSLKRGNKDLKKRKMEENTSINLSKQESFTSVKKPKRDDSKDLALCSMILTEMETHEDA
WPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNED
DSDIGRAGHNMRKYFEKKWTDTFKPLNPHSL
Download sequence
Identical sequences G7PKM9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]