SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7XA50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7XA50
Domain Number 1 Region: 3-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.41e-88
Family Capz alpha-1 subunit 0.00000735
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7XA50
Sequence length 272
Comment (tr|G7XA50|G7XA50_ASPKW) F-actin capping protein alpha subunit {ECO:0000313|EMBL:GAA83749.1} KW=Complete proteome; Reference proteome OX=1033177 OS=awamori var. kawachi). GN=AKAW_01864 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MASTTELASSFIEGAPPGELADVVADVKALTSDGPDIIPSLAPAFERYNETQLTTVKLPG
ASQEVLISEYNKLEGNRYFDVESQTSFEVDHVTQEASAAQSYVLESQNADLIKSLLKSLS
AHATEHYRTCSYGVYPIEDDTAVAIVLVANRYSPNNFWNGRFRAIYTLPVNSSSTTISGQ
IKVDVHYYEDGNVALNTNKPVNLSVPSVDASSIISRIAAAERDYQEELNRAFVSTAEGVF
KGLRRQLPITRQKVEWEKVGGYRLGQDIAGGR
Download sequence
Identical sequences G7XA50

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]