SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7XIC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7XIC6
Domain Number 1 Region: 363-419
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.88e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00065
Further Details:      
 
Domain Number 2 Region: 2-46
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000602
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7XIC6
Sequence length 419
Comment (tr|G7XIC6|G7XIC6_ASPKW) Transcription factor TFIIA complex subunit Toa1 {ECO:0000313|EMBL:GAA86716.1} KW=Complete proteome; Reference proteome OX=1033177 OS=awamori var. kawachi). GN=AKAW_04830 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MSNQQVGTVFDRVIQEVCDGSQVDFEESGVDQQTLLDLRKSWQKKLSSLGVAHFPWDPPP
PQAAPPQTQNILPPTATVPSNAPRPGPPPQPQHHVPPPPPQQQPIPQSVPATAPPLQAPA
PVGAGPNAMGQQQQQPHIKTEPGVNGQPGMMPMNNMMMPNSSNPQSAQERAANMLRQRYG
AAAANSVSQLQAQSQAQAAMAIPGQPRPQPMQHVPNGQAPQIKQEPGYPPVSQPPVGNTQ
TDGAGDDALSAWKAEVARRREAAERQGGEGDRLLRDHLRQQMLQLEGGGLMLPLDEHDYS
SKTSTRGLVATQAEPADVSAVAGSSSHPPKVLGAQFDGPGGDDERDEDDEDAINSDLDDP
DDLVAEDHDAEDAVGQVMLCTYDKVQRVKNKWKCTLKDGILTTGGKEYVFHKGQGEFEW
Download sequence
Identical sequences A0A146FB88 G7XIC6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]